Protein Info for Psest_0459 in Pseudomonas stutzeri RCH2

Annotation: Predicted carbamoyl transferase, NodU family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02543: Carbam_trans_N" amino acids 5 to 354 (350 residues), 166.8 bits, see alignment E=9.8e-53 PF16861: Carbam_trans_C" amino acids 406 to 575 (170 residues), 205.4 bits, see alignment E=4.8e-65

Best Hits

KEGG orthology group: K00612, carbamoyltransferase [EC: 2.1.3.-] (inferred from 96% identity to psa:PST_3842)

Predicted SEED Role

"Carbamoyltransferase in large core OS assembly cluster"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGE1 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Psest_0459 Predicted carbamoyl transferase, NodU family (Pseudomonas stutzeri RCH2)
MALTILGLSGALSHDPSAALYIDGKLIAAVEEERFVRDKHAKNRMPYESAKFCLEQAGIK
PSDVDVVAIPFAPISIFEKARWHYAKRYWYAPDRALDAILMGNRRYYRYKKRIEWCLQQL
GFDLKKVKLQPVEHHLAHASSAYHCSGFTEKTAILGIDGKGEYATTFFGWGENGKIHKVK
EFYDPDSLGGLYGAITEYLGFEMLDGEFKVMGMAPYGDAAKYDFSRLATFENGELTINTE
YANVIGFRRYKEKGKGYYFSPKLIEWLGPKREGDIADDPYIHYAAAMQALFEKLALQMMD
YYLGGIIRETGKIAFAGGCALNVKLNQKIIARDEVKELFVQPASGDAGTAVGAAAYVSVQ
RGVPVEKMEHVYLGPSYSNEDVIAACAKHPNKPVFKQITNTPERIARIMADGNPVAWFQG
RMEFGPRALGGRSIIGCPSVPGVADRINEQIKFRERWRPFCPSMLDTVAPQMLKVDHPSP
FMTFTFEVNEGWKERVGEVVHEDGTSRAQVLERRHNPRWYDLMLELEKLTGNGVSLNTSL
NRRGEPMICSPTDALNMFYGSDLQYLIMEDILVVKDGKDWYDNN