Protein Info for PGA1_c04640 in Phaeobacter inhibens DSM 17395

Annotation: enoyl-[acyl-carrier-protein] reductase FabI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to FABI1_RHIME: Enoyl-[acyl-carrier-protein] reductase [NADH] 1 (fabI1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00208, enoyl-[acyl-carrier protein] reductase I [EC: 1.3.1.9] (inferred from 88% identity to sil:SPOA0439)

MetaCyc: 57% identical to enoyl-(acyl-carrier-protein) reductase [NADH] (Agrobacterium fabrum C58)
Enoyl-[acyl-carrier-protein] reductase (NADH). [EC: 1.3.1.9]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.3.1.9)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
oleate biosynthesis IV (anaerobic) (13/14 steps found)
biotin biosynthesis I (13/15 steps found)
(5Z)-dodecenoate biosynthesis I (6/6 steps found)
palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
gondoate biosynthesis (anaerobic) (4/4 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
(5Z)-dodecenoate biosynthesis II (5/6 steps found)
stearate biosynthesis II (bacteria and plants) (5/6 steps found)
8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
cis-vaccenate biosynthesis (4/5 steps found)
fatty acid elongation -- saturated (4/5 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
streptorubin B biosynthesis (20/34 steps found)
mycolate biosynthesis (21/205 steps found)
superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJ70 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PGA1_c04640 enoyl-[acyl-carrier-protein] reductase FabI (Phaeobacter inhibens DSM 17395)
MSGVLTGKRGLIMGVANDRSIAWGIAKAMAEAGADLAFTYQGEAFGKRLEPLAQSVGSDF
MVDVDVTDDASLDTAFEQLSARWDSIDFVVHAIAYSDKAELTGRFLDTSRENFKNSMDIS
AYSFVEVARRAYPLMKDAGGTLLTLTYQGSNRVVPNYNVMGVAKAALESATRYLANDLGP
EGIRVNAISPGPMKTLAGAAIGGARKTFKHTAQNAPMRDNATLEAVGGTAVYLASDAGAC
TTGEVIRVDGGFHVLGMPQQDNL