Protein Info for PGA1_c04620 in Phaeobacter inhibens DSM 17395

Annotation: peptidyl-prolyl cis-trans isomerase, FKBP-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF00254: FKBP_C" amino acids 3 to 139 (137 residues), 91.8 bits, see alignment E=1.4e-30

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 73% identity to sil:SPOA0438)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DM29 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PGA1_c04620 peptidyl-prolyl cis-trans isomerase, FKBP-type (Phaeobacter inhibens DSM 17395)
MTEVKSGDTVRIHYTGKLTDGSVFDSSEGREPLEFTVGSGQVIEGMDAGLIGMTAGETKT
LDIPADQAYGPSHDEARQTIPREGIPDDIPLEVGTQLQMQAPTGEVLPVTVVEVTEATVT
LDANHPLAGKDLIFDIELVSIN