Protein Info for PGA1_c04610 in Phaeobacter inhibens DSM 17395

Annotation: haloacid dehalogenase, type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00702: Hydrolase" amino acids 3 to 190 (188 residues), 78.6 bits, see alignment E=1.2e-25 TIGR01428: haloacid dehalogenase, type II" amino acids 4 to 204 (201 residues), 198.4 bits, see alignment E=1.3e-62 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 6 to 188 (183 residues), 94.4 bits, see alignment E=8.9e-31 PF13419: HAD_2" amino acids 97 to 198 (102 residues), 45.6 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 43% identical to HAD_PSEUY: (S)-2-haloacid dehalogenase from Pseudomonas sp. (strain YL)

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 76% identity to sil:SPOA0437)

MetaCyc: 43% identical to S-2-haloacid dehalogenase (Burkholderia sp. WS)
(S)-2-haloacid dehalogenase. [EC: 3.8.1.2]; 2-haloacid dehalogenase (configuration-inverting). [EC: 3.8.1.2, 3.8.1.10]

Predicted SEED Role

"Haloacid dehalogenase, type II (EC 3.8.1.2)" (EC 3.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.10 or 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWJ8 at UniProt or InterPro

Protein Sequence (228 amino acids)

>PGA1_c04610 haloacid dehalogenase, type II (Phaeobacter inhibens DSM 17395)
MAITTCIFDAYGTLFDVTAAARQAAQEPEFPHLIDHWAELANHWRLKQLQYTWLRAITNA
HTDFWQVTQDGLDWAMEATGLSGDPQLRKRLLDLYWQLQAYEEVPEMLRTLKAAGLQTAI
LSNGSPKMLEGAVNSAGVSGLLDDVLSVEAVGVFKPAAQVYDLVEARFSCQRDEVLFVSS
NGWDAAGAAGYGFTTAWVNRGGEPMDRLPWTPHHVLSDLSSIPKLLDT