Protein Info for PGA1_c04600 in Phaeobacter inhibens DSM 17395

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00561: Abhydrolase_1" amino acids 2 to 215 (214 residues), 50.3 bits, see alignment E=3.9e-17 PF12697: Abhydrolase_6" amino acids 2 to 215 (214 residues), 55.2 bits, see alignment E=2.3e-18 PF12146: Hydrolase_4" amino acids 3 to 70 (68 residues), 28.5 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 61% identity to sil:SPOA0436)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DXK9 at UniProt or InterPro

Protein Sequence (229 amino acids)

>PGA1_c04600 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Phaeobacter inhibens DSM 17395)
MITLDARGRGRSQYAEDIHSYSVPREAQDVIELLDHLNIDRVTILGTSRGGLVAMALAAL
HKHRLAGVILNDVGPEIPADGIARIMAYVGHRPAAKTYEQAASALAAYMAPAFPGIPMAR
WREEVEVFYTQTPEGLALRYDARLRDALLAQAAAGPTPDLWPLFQSLSGVPSGVIRGSNS
DILSPDTYQKMQLHLPELLAVEVPDRGHVPFLDEPSSLALIHRILEIAQ