Protein Info for Psest_0453 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF00534: Glycos_transf_1" amino acids 184 to 348 (165 residues), 118 bits, see alignment E=5.1e-38 PF13692: Glyco_trans_1_4" amino acids 200 to 320 (121 residues), 65.3 bits, see alignment E=1.1e-21 PF20706: GT4-conflict" amino acids 203 to 346 (144 residues), 45.8 bits, see alignment E=6.4e-16

Best Hits

Swiss-Prot: 51% identical to RFAG_ECOLI: Lipopolysaccharide core biosynthesis protein RfaG (rfaG) from Escherichia coli (strain K12)

KEGG orthology group: K02844, UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC: 2.4.1.-] (inferred from 90% identity to psa:PST_3847)

MetaCyc: 52% identical to lipopolysaccharide glucosyltransferase I (Salmonella enterica enterica serovar Typhimurium str. LT2)
2.4.1.M73 [EC: 2.4.1.M73]

Predicted SEED Role

"UDP-glucose:(heptosyl) LPS alpha1,3-glucosyltransferase WaaG (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.M73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI40 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Psest_0453 Glycosyltransferase (Pseudomonas stutzeri RCH2)
MQLAFILYKYFPFGGLQRDFMRIALECQRRGHTIRVYAMIWEGDVPDGFEVLIAPVKALF
NHTRNERFTAWVEADLSKRPVDRVIGFNKMPGLDVYYAADPCFEDKAQTLRNPIYRRWGR
YKHFAEYERAVFAPEAKTEILMISEVQQPLFVKHYGTPAERFHLLPPGIAQDRRAPANAA
QIRAEFREEFEVRPDELLLVQIGSGFKTKGVDRSLKALAALPRELSQRTRLLVIGQDDPK
PFKLQAKALGVSGMVEFLRGRSDIPRFLLGADLLIHPAYNENTGTVLLEALVAGLPVLVS
DVCGYAHYIADADCGRVVPGPFEQSVLDRMLAQMLAEDQQRAAWSRNGLAYAETADLYSM
PQKAADVILEERA