Protein Info for PGA1_c04570 in Phaeobacter inhibens DSM 17395

Annotation: putative 3-oxoadipate enol-lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 85 to 105 (21 residues), see Phobius details TIGR02427: 3-oxoadipate enol-lactonase" amino acids 10 to 257 (248 residues), 315.6 bits, see alignment E=1.1e-98 PF00561: Abhydrolase_1" amino acids 22 to 132 (111 residues), 57.4 bits, see alignment E=3.7e-19 PF12697: Abhydrolase_6" amino acids 24 to 250 (227 residues), 67.7 bits, see alignment E=4.9e-22 PF12146: Hydrolase_4" amino acids 49 to 136 (88 residues), 37.8 bits, see alignment E=2.8e-13 PF03096: Ndr" amino acids 69 to 261 (193 residues), 26.9 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 66% identity to sil:SPOA0434)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DM25 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PGA1_c04570 putative 3-oxoadipate enol-lactonase (Phaeobacter inhibens DSM 17395)
MPFVDLGDVQLHYQLDGTADGPPLVFANSLGTDLHVWDLVVERLPKELRIIRYDLRGHGG
TPATPAPYSMGTLVRDAERLLDQLQVKGCIFVGLSIGGMIAQGLAIKRLDLMRGLVLSNT
AAKIGTAAAWQQRIEAIKRDGIDAVADTIMERWFAPAFRKSPELSHWRAHLLQQSVEGYI
GCCAAISGTDFYTPTSGLRLPTLGIAGSDDGATPADLVRETVDLIPGSKFELIRRAGHIP
CVEQPEVFADRLITFLTEQGHI