Protein Info for PGA1_c04570 in Phaeobacter inhibens DSM 17395

Annotation: putative 3-oxoadipate enol-lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 10 to 257 (248 residues), 315.6 bits, E=1.1e-98
• PF00561: Abhydrolase_1
  • amino acids 22 to 132 (111 residues), 57.4 bits, E=3.7e-19
• PF12697: Abhydrolase_6
  • amino acids 24 to 250 (227 residues), 69.3 bits, E=1.6e-22
• PF12146: Hydrolase_4
  • amino acids 49 to 135 (87 residues), 37.8 bits, E=2.7e-13
• PF03096: Ndr
  • amino acids 69 to 261 (193 residues), 26.9 bits, E=3.9e-10

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 66% identity to sil:SPOA0434)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• superpathway of salicylate degradation (5/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (4/6 steps found)
• catechol degradation to β-ketoadipate (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See I7DM25 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PGA1_c04570 putative 3-oxoadipate enol-lactonase (Phaeobacter inhibens DSM 17395)
MPFVDLGDVQLHYQLDGTADGPPLVFANSLGTDLHVWDLVVERLPKELRIIRYDLRGHGG
TPATPAPYSMGTLVRDAERLLDQLQVKGCIFVGLSIGGMIAQGLAIKRLDLMRGLVLSNT
AAKIGTAAAWQQRIEAIKRDGIDAVADTIMERWFAPAFRKSPELSHWRAHLLQQSVEGYI
GCCAAISGTDFYTPTSGLRLPTLGIAGSDDGATPADLVRETVDLIPGSKFELIRRAGHIP
CVEQPEVFADRLITFLTEQGHI