Protein Info for HP15_p187g149 in Marinobacter adhaerens HP15

Annotation: 2Fe-2S ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00111: Fer2" amino acids 8 to 90 (83 residues), 43.8 bits, see alignment E=9.7e-16

Best Hits

Swiss-Prot: 56% identical to FER2_CAUVC: 2Fe-2S ferredoxin (fdxB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04755, ferredoxin, 2Fe-2S (inferred from 63% identity to gpb:HDN1F_17550)

MetaCyc: 47% identical to carbazole 1,9a-dioxygenase ferredoxin component (Sphingomonas sp. XLDN2-5)
RXN-11511 [EC: 1.14.12.22]

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PSB1 at UniProt or InterPro

Protein Sequence (106 amino acids)

>HP15_p187g149 2Fe-2S ferredoxin (Marinobacter adhaerens HP15)
MGHITFIEHNGTQHKIKIEPDKSLMQHATDNMVPGIDADCGGACACGTCHVVVDDAWYAK
TGKTNIVEQQMLDMTPERAPTSRLACQIEITDAMDGLVVRLPEFQM