Protein Info for PGA1_c04540 in Phaeobacter inhibens DSM 17395

Annotation: putative d-galactonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF02746: MR_MLE_N" amino acids 23 to 118 (96 residues), 44.2 bits, see alignment E=2.1e-15 PF13378: MR_MLE_C" amino acids 150 to 372 (223 residues), 216.1 bits, see alignment E=5.1e-68

Best Hits

KEGG orthology group: None (inferred from 83% identity to sil:SPOA0428)

Predicted SEED Role

"Muconolactone isomerase (EC 5.3.3.4),putative" in subsystem Catechol branch of beta-ketoadipate pathway (EC 5.3.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.3.4

Use Curated BLAST to search for 5.3.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJ61 at UniProt or InterPro

Protein Sequence (410 amino acids)

>PGA1_c04540 putative d-galactonate dehydratase (Phaeobacter inhibens DSM 17395)
MKLQDLDIIVTAPPAPGWGGRYWILVKVTTDTGITGWGECYAASVGPDAMTHVIRDVFER
HMQGMNPENIEWMFRRAYSSGFTQRPDLSVMGAFSGLEIACWDILGKDRDRPVHALIGGR
MNDRLRAYTYLYPLPHHDIDAFWNTPELAAESAIAAVEKGYTAVKFDPAGPYTMRGGHMP
AQSDITQSVAFCRAIREAVGDRADLLFGTHGQFTPAGAIRLGQALESYEPLWFEEPTPPD
LVADMARVADRVRIPVATGERLTTKAEFAAILRAGAAEILQPALGRSGGIWETKKIAAIA
EVFGAQMAPHLYAGPVEWAANIQLAASIPNLLMIETIETPFHTALIKQGITVEDGFVIPS
DTPGLGIEVDEDLARANPFIGDDLHLNMQDAPCNYAEGNSFVGGAPPMED