Protein Info for HP15_p187g134 in Marinobacter adhaerens HP15

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00561: Abhydrolase_1" amino acids 61 to 309 (249 residues), 66.4 bits, see alignment E=3.2e-22 PF12697: Abhydrolase_6" amino acids 62 to 317 (256 residues), 50.2 bits, see alignment E=5.5e-17

Best Hits

KEGG orthology group: None (inferred from 46% identity to pmy:Pmen_3331)

Predicted SEED Role

"L-fuco-beta-pyranose dehydrogenase (EC 1.1.1.122)" (EC 1.1.1.122)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PS96 at UniProt or InterPro

Protein Sequence (326 amino acids)

>HP15_p187g134 short chain dehydrogenase (Marinobacter adhaerens HP15)
MRRGAVESWPTLLPTLINKLGYDRDTVEAREYTVSQQKTHWIISGDLLIHAVIEGDSKAT
PLVLVHGYPDNLQVWDQVTQRLKDRYLIIRYDVRGAGKSDKPSKTNSYKLPLLAKDLEAV
VNALIPGRGFHLIAHDWGSIQCWESVTGNTLKDRILSYTSISGPCLDHVGWWIRNAVSSA
NLPKLKRMADQLAHSWYVFMFQIPVVPEAIWRIGLDKYWPDYLKKHEEISDATYHSSQRD
DGQYGVKLYRANFVSRLLNPRIRIARCPVQVIVPKRDAYVRPQLMDGLSSWVADLKILAI
DAPHWAPITQPERVAQAVSQFVTEHS