Protein Info for HP15_426 in Marinobacter adhaerens HP15

Annotation: signal transduction histidine kinase, nitrogen specific, NtrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00989: PAS" amino acids 11 to 106 (96 residues), 27.5 bits, see alignment E=4.1e-10 PF00512: HisKA" amino acids 138 to 191 (54 residues), 61.2 bits, see alignment 1.2e-20 PF02518: HATPase_c" amino acids 238 to 361 (124 residues), 63.2 bits, see alignment E=4.5e-21

Best Hits

Swiss-Prot: 47% identical to NTRB_VIBAL: Sensory histidine kinase/phosphatase NtrB (ntrB) from Vibrio alginolyticus

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 88% identity to maq:Maqu_0767)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMR2 at UniProt or InterPro

Protein Sequence (364 amino acids)

>HP15_426 signal transduction histidine kinase, nitrogen specific, NtrB (Marinobacter adhaerens HP15)
MALPSAHPTGYKSILDSLTTAVLVLEDSLAIQYLNPAAESLFETSMTRSQGQPFQDILVE
SEDALKTLFAAVRNGQSYTRREAEFLLTSGSRLTVDYSVTPISLEPTELLIEIQPRDRLM
RISREEDIISQQETTRILVRGMAHEIKNPLGGIRGAAQLLDRELSSEDQREYTRVIIDEA
DRLRSLVDRMLGPNKALKLAPTNIHEILERVGTLLEAESKGRLNFERDYDPSIPEFKGDK
EQLIQAFLNIARNAMEAAFENQGGHSSEEPPTITFRTRTLRQFTIGNRRHKLVCRVDVID
NGPGIPPELVQNIFYPMISGRASGTGLGLSITQSIIGQHRGLVECESEPGRTDFIIFLPL
EDTP