Protein Info for HP15_425 in Marinobacter adhaerens HP15

Annotation: two-component response regulator NtrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 99 bits, see alignment E=4.8e-32 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 465 (459 residues), 763.8 bits, see alignment E=3.2e-234 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 245.3 bits, see alignment E=6.6e-77 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 86.5 bits, see alignment E=5.3e-28 PF07728: AAA_5" amino acids 167 to 285 (119 residues), 34.5 bits, see alignment E=4.8e-12 PF02954: HTH_8" amino acids 425 to 464 (40 residues), 45.1 bits, see alignment 1.7e-15

Best Hits

Swiss-Prot: 66% identical to NTRC_SALTY: DNA-binding transcriptional regulator NtrC (glnG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 94% identity to maq:Maqu_0766)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMR1 at UniProt or InterPro

Protein Sequence (475 amino acids)

>HP15_425 two-component response regulator NtrC (Marinobacter adhaerens HP15)
MSQPANVWIIDDDRSIRWVLERALNQAGMQPRVFDSGESIMMRLEHEQPDAIVSDIRMPG
VDGITLLSQIVDVHPDVPVIIMTAHSDLESAVTSYQTGAFEYLPKPFDVDDAVALVKRAV
AHSHEKRASGEPQAEMAQRNAEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELV
AQALHNHSPRANHPFIALNMAAIPKDLIESELFGHEKGAFTGAGAARQGRFEQANGGTLF
LDEIGDMPADTQTRLLRVLADGEFYRVGGTTPIKVDVRIIAATHQDLEKLVQAGTFREDL
FHRLNVIRVHLPKLAERREDIPRLMQHFLKRAAKELAVEPKILREEAEEYLTTLPWPGNV
RQLENTCRWLTVMASGREIHIDDLPPELLHQAETPTTGTTWQEGLKNWAEQELKRGKKGI
LDTAVPEFEKIMIETALKHTGGRRRDASILLGWGRNTLTRKINELGMDHPEHEDD