Protein Info for HP15_p187g67 in Marinobacter adhaerens HP15

Annotation: glycosyl transferase group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF13477: Glyco_trans_4_2" amino acids 22 to 162 (141 residues), 33.9 bits, see alignment E=1.1e-11 PF20706: GT4-conflict" amino acids 178 to 376 (199 residues), 38.9 bits, see alignment E=1.6e-13 PF00534: Glycos_transf_1" amino acids 203 to 360 (158 residues), 90.6 bits, see alignment E=2.7e-29 PF13692: Glyco_trans_1_4" amino acids 205 to 344 (140 residues), 81 bits, see alignment E=3.1e-26 PF13524: Glyco_trans_1_2" amino acids 287 to 373 (87 residues), 28.5 bits, see alignment E=4.4e-10

Best Hits

KEGG orthology group: None (inferred from 60% identity to aeh:Mlg_2341)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PS29 at UniProt or InterPro

Protein Sequence (393 amino acids)

>HP15_p187g67 glycosyl transferase group 1 family protein (Marinobacter adhaerens HP15)
MVFEALNLQGGTILNPVVFLTSNTSWYLYNFRASTIQALREQGNRVVCLSPSDDFSQRLV
DDLGAEHIALPLDGKSTGAVQELRSLRFIWSVMREYRPDFVFNFTVKMNIYCGLVCAFQK
VPFANNISGLGTAFIHDSWLFRRVRQVYGLVNRRSQKLFFQNEEDLGVFQSKGLLSDTPY
TLLPGSGVDLARFRLSPLPEDLPFTFIMIARLLGDKGVREYAEASRKLKADGLNVRCLLV
GPLGVSNRTAISEDEVRQWQSEGIVDYSGATDDVRLLIEQAHVLVLPSYREGMPRTVLEA
AAMGRPAIVTDVPGCRHAIEPGVTGWLCEVRNADSLAAQMRAVAQSDEETLKRAGISARR
RMEAQFSETLVVKAYLDCLAASSPLFLARKSSV