Protein Info for HP15_p187g55 in Marinobacter adhaerens HP15

Annotation: UDP-N-acetylglucosamine 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to SACA_NEIMA: UDP-N-acetylglucosamine 2-epimerase (sacA) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 47% identity to xne:XNC1_0386)

MetaCyc: 44% identical to UDP-N-acetylglucosamine 2-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine 2-epimerase. [EC: 5.1.3.14]

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

CMP-N-acetylneuraminate biosynthesis II (bacteria) (3/3 steps found)
UDP-N-acetyl-α-D-mannosamine biosynthesis (1/1 steps found)
CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (2/5 steps found)
superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)
superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.14

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PS17 at UniProt or InterPro

Protein Sequence (370 amino acids)

>HP15_p187g55 UDP-N-acetylglucosamine 2-epimerase (Marinobacter adhaerens HP15)
MKVLMIVGTRPEAIKMIPVYRTLSAREDMTACLLLTGQHREMARSVLDLFGVNADIDLDL
MEHGQTLLSLSARLTAGLSRVIVDEQPDVILVQGDTTSAMIGGMLGFYAGCRVGHIEAGL
RTGNLASPFPEEFNRRVITLGAHWHFAPTAAAAENLRSEGITLNVHTVGNTVIDAALDMA
DQMTPGKAAMFDQLPFLDDSSGKSVLVTVHRRENIGTRMAGIAAAVGELATLHSSTHFVV
PVHPNPAVGAVVRPILESLENVHLIAPLYYDQMIYMLSRAFLVLTDSGGIQEEAPSFNVP
VLVLRNESERMEGVDAGCSRLVGTEPSCIVKEAQTLLSDPVAHAMMANSANPYGDGCASQ
KIAQILSGIE