Protein Info for HP15_p187g45 in Marinobacter adhaerens HP15

Annotation: protein-tyrosine phosphatase, low molecular weight

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 4 to 143 (140 residues), 110.2 bits, E=5.2e-36

Best Hits

Swiss-Prot: 49% identical to AMSI_ERWAM: Probable low molecular weight protein-tyrosine-phosphatase AmsI (amsI) from Erwinia amylovora

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 53% identity to pva:Pvag_1983)

MetaCyc: 46% identical to phosphotyrosine-protein phosphatase Etp (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

See E4PS07 at UniProt or InterPro

Protein Sequence (144 amino acids)

>HP15_p187g45 protein-tyrosine phosphatase, low molecular weight (Marinobacter adhaerens HP15)
MFDNILVLCVGNICRSPVAEAFLKAELPGKSVRSAGLGALVGHPADPTAQTLANAEGLNV
ADHRAQQVTPAMLGEADLILVMSRDQRGQVRKLHPASGGKTMLLTHWLPGQPDISDPYKK
STEAFEHVHKQIVSAAKAWLPKLS