Protein Info for Psest_4399 in Pseudomonas stutzeri RCH2

Annotation: Predicted P-loop ATPase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF05272: VapE-like_dom" amino acids 275 to 490 (216 residues), 173.1 bits, see alignment E=3e-55

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU11 at UniProt or InterPro

Protein Sequence (568 amino acids)

>Psest_4399 Predicted P-loop ATPase and inactivated derivatives (Pseudomonas stutzeri RCH2)
MTVHIQRPSIGLAMPAALSKISPIEHFKSLPKARKGSGEWWAACCPAHEDKSPSLGFTEH
SNGDIGFVCRAGCDKESILGAMGLTWSDVFADGMTLTARVQYHRKNLESERRNLDVLVSI
AEANPADVLESEIPLVAKSQARLEAIAAELKEIERAHLDMPLESPQAIYHPSQIVWRQDK
ETGELSFVRAQGTAENLSRMVSAYGVRIRYNELSRDVEISVNGKRPTGDLARNVSLSLIE
DLCRINSYPYTQAGSHLDRLAAQDAYNPALDWVRSRRWDGGEHVRALFECLTLADESKTA
ISWTLFRKWFLGAAAILSGHANKFEHVLILVDPLGGLGKTRFFNSLCPKEFQADGVTLNP
DDKDSVLLAVSKWLVELGEIGATFKKSDIESLKAFLSRETDEIRPAYARAANQYQRRTAF
FGSVNNVQFLMDDTNNRRFWPIQVAAVEYQHTVNVQQAWAEALSLVEAGETWHLNPEENR
AIAEHNDAFRSKDAVEELILSSYDPEDLRDRWLSATDVLRELGFDKPARSDSLKAGALLR
KLYKHRMLRGTTVYLLPDPIMEARKRIY