Protein Info for PGA1_c04430 in Phaeobacter inhibens DSM 17395

Annotation: putative peptide permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 112 to 139 (28 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 305 to 331 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 4 to 116 (113 residues), 31.3 bits, see alignment E=2e-11 PF00528: BPD_transp_1" amino acids 130 to 336 (207 residues), 91.4 bits, see alignment E=6e-30

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 88% identity to sil:SPO0559)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETX9 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c04430 putative peptide permease protein (Phaeobacter inhibens DSM 17395)
MEILRYAIYRFGTMLLTLLVVSVLVFIIINLPPGDYLSNQIAELRASGQSSGVEKAEFLR
KEYALDRPLWQQYMIWMGFMPGPHGFSGMIQGNFGWSFEFDRPVAEIVGESLWLTVLVNV
AAVLFVYLVALPLGVLAAARSRTWVDYTSAFVGYLGLATPNFLLALILFYYGHKYFDLPI
GGLMDPAFEGEPMTWAKVKSILIHLIVPTFVIGTSGASAMMQRLRANMLDELGKPYVETA
IAKGMAPARMLTKYPLRVAFNPFVADIGNLLPAMISGSVLVSVVLGLQTIGPTLLTALKT
QDMFLSGFVLMFVALLTLIGTMISDVLLVMLDPRIRYEERKR