Protein Info for Psest_0043 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details PF20730: YetF_N" amino acids 24 to 90 (67 residues), 33.8 bits, see alignment E=2.5e-12 PF04239: DUF421" amino acids 95 to 163 (69 residues), 38.3 bits, see alignment E=8.8e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_4148)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF65 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Psest_0043 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MEVLVEGMFFSNGTTLIRTLVVGVLAYISLVLLLRLSGRLTLSKMNAFDLVVTVALGSTF
ATILLNRDVSLAEGVLALALLIGLQYVVTWSSVRVAWVRRTVTGEPALLFFRGRFLDDAM
RVARVTEDEVRAAARSQGLAALDGIEAVVLETDGSFSVIADGAGDSRSTLDGVNVPGPNE
KGV