Protein Info for Psest_4371 in Pseudomonas stutzeri RCH2

Annotation: Multisubunit Na+/H+ antiporter, MnhB subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details PF04039: MnhB" amino acids 5 to 123 (119 residues), 108.4 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 36% identical to MRPB_BACPE: Na(+)/H(+) antiporter subunit B (mrpB) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05566, multicomponent Na+:H+ antiporter subunit B (inferred from 86% identity to psa:PST_4208)

Predicted SEED Role

"Na(+) H(+) antiporter subunit B" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU55 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Psest_4371 Multisubunit Na+/H+ antiporter, MnhB subunit (Pseudomonas stutzeri RCH2)
MNSLIFAAFSRTLFILMLAVSLYVLYRGHNEPGGGFVGGLIAAAGFATLALARGVDVARA
TLRFDPMTVIGCGILAALLGGLPGLWLDDSFLAHQWAILGSVHIGTTLLFDIGVYLVVLG
GILSLILRFCEGL