Protein Info for HP15_417 in Marinobacter adhaerens HP15

Annotation: type II secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 174 to 194 (21 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details PF28597: T2SSF_N" amino acids 2 to 42 (41 residues), 37.7 bits, see alignment 1.4e-13 PF00482: T2SSF" amino acids 72 to 195 (124 residues), 98.6 bits, see alignment E=2.7e-32 amino acids 275 to 397 (123 residues), 112.3 bits, see alignment E=1.6e-36

Best Hits

KEGG orthology group: K12278, MSHA biogenesis protein MshG (inferred from 88% identity to maq:Maqu_0757)

Predicted SEED Role

"MSHA biogenesis protein MshG" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMQ3 at UniProt or InterPro

Protein Sequence (409 amino acids)

>HP15_417 type II secretion system protein (Marinobacter adhaerens HP15)
MQFSYRGKDDRGGVQQGLLGAPNADAAATELMRRGITPLAIREVQETESVIDRLNRLPIF
RKKVTLDELIVFCRQMHALTKAGIPLIRTMRGLAETTRSPVLAEVLEDVTTRLEGGTTMA
TAMQAHPKVFSELFIAMIHVGENTGMLDDAFRRLSEILELERDTKRRLKQAMRYPMFVII
ALLSALMIVNFLVIPKFASVFNKLGADLPFLTQVLVGTSNFLLAYWYVMLFAVAAGGLLL
RQWKQTEQGRLTWDRYKLKLPIIGPLLELITLSRFSRNFATMLSAGMPVTTALTVVADTT
DNAWISSHIKDMRAGIERGESLLRTARHSEMFTPLILQMIAVGEETGSVDDMLNNVADFY
DEDVDYGLKRLAESIEPILIVAMGILVLILALGVFLPIWDLGAAAMGRG