Protein Info for Psest_4361 in Pseudomonas stutzeri RCH2

Annotation: F0F1-type ATP synthase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 transmembrane" amino acids 14 to 40 (27 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details PF03899: ATP-synt_I" amino acids 2 to 94 (93 residues), 56.9 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 58% identical to ATPZ_PSEAE: ATP synthase protein I (atpI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02116, ATP synthase protein I (inferred from 96% identity to psa:PST_4198)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU43 at UniProt or InterPro

Protein Sequence (113 amino acids)

>Psest_4361 F0F1-type ATP synthase, subunit I (Pseudomonas stutzeri RCH2)
MQAMVVVVTAVSCGLVFGIVAGYSALCGGLIALSANVYFAYKAFRYFGARSTRAIIQSFW
SGEMGKQILAAALFALVFVGVKPLEPIALFAGYLLVLGVGASALLLMKNNPKH