Protein Info for HP15_p42g46 in Marinobacter adhaerens HP15

Annotation: conjugal transfer, TrbH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF07283: TrbH" amino acids 21 to 171 (151 residues), 120.8 bits, see alignment E=1.9e-39

Best Hits

KEGG orthology group: None (inferred from 57% identity to ajs:Ajs_4268)

Predicted SEED Role

"Conjugative transfer protein TrbH" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRV6 at UniProt or InterPro

Protein Sequence (171 amino acids)

>HP15_p42g46 conjugal transfer, TrbH (Marinobacter adhaerens HP15)
MRKLIVAVLFSLGLAGCATHAPYGNFVENPAGLNQQEIASDTVEKITELYPPAKTRFELK
QPTPDAFGTALVRGLRDRGYALLEFDPEAAKAQQRQQATRSTRTAPSAEATPAPANPAPT
GSGLPLRYVFDQFTGTNMYRVTIMVGNESLTRPYSQENGGIVPAGYWVRKE