Protein Info for HP15_p42g45 in Marinobacter adhaerens HP15

Annotation: conjugation TrbI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details PF03743: TrbI" amino acids 283 to 466 (184 residues), 227.8 bits, see alignment E=5e-72

Best Hits

KEGG orthology group: K03195, type IV secretion system protein VirB10 (inferred from 65% identity to eba:p2B8)

Predicted SEED Role

"Conjugative transfer protein TrbI" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRV5 at UniProt or InterPro

Protein Sequence (475 amino acids)

>HP15_p42g45 conjugation TrbI family protein (Marinobacter adhaerens HP15)
MSENNDQMSPDASPGEVSKKSGVRRVNNRPMYILFGVLGLFLLVMMMVAADRAAQQNAPS
EGPKERAGNTSMFANEIAGTQTDGFIPAAEPPAVPSLDEPVAPNDEAPQEDNQDAAPVTV
ARPVNPDLPPAPPQNTGSQAQRDDEAERIRMAKLQMLEQAVRAKTGVQAVAPRSSSDGGS
SQPVNNRPQSRQDMINEIARVRQQIASNRSDDPTAAYQQRMAQIEGMRNGGGFGGNGGST
SAPMLMQTSANGSGNGYSQFDSNGGDRWQLGEQVQAPRSPYELRAGFVIPATLISGINSD
LPGQIVAQVSQDVSDTATGSHLLIPQGSRLVGSYSNDVAYGQERVLIAWQRIIFPDGKAL
DIGSMPGADAAGYSGFHDQVNNHYLRIFGSAFLMSGVTAGVTLSQDNDNNSDSNNQRASD
ALSEALGQQLGQVMVEMIRKNMNIAPTLEIRPGYRFNVIVTKDMTFSKPYSSFDY