Protein Info for HP15_p42g39 in Marinobacter adhaerens HP15

Annotation: TrbP protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 129 (17 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 173 to 202 (30 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details PF05857: TraX" amino acids 25 to 231 (207 residues), 164.5 bits, see alignment E=1.8e-52

Best Hits

KEGG orthology group: None (inferred from 75% identity to ajs:Ajs_4260)

Predicted SEED Role

"Conjugative transfer protein TrbP (IncF TraX homolog)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRU9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_p42g39 TrbP protein (Marinobacter adhaerens HP15)
MTDSTASLKSSWSLPRLFVADGTVEGLKWLGLLLMTGDHVNKYLFNGTLPFLFEAGRLAM
PIFVFVLAFNLARPGQLEKGVYQRTMKRLAVFGALASVPFIALGGLYAGWWPLNILFTLL
ALTATAYLIERGHTAWAALVFMNAGAMVEYWWPALLFGLAVWSYARKPTLSAAGVAVIAC
AALGFVNGNMWALAVLPLLFVATFFDLRMPRLRWVFYAYYPLHLGALWLIRIPMSHAGYL
FF