Protein Info for Psest_4352 in Pseudomonas stutzeri RCH2

Annotation: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase
  • amino acids 4 to 452 (449 residues), 655.8 bits, E=1.7e-201
• PF01128: IspD
  • amino acids 5 to 130 (126 residues), 31.8 bits, E=3.3e-11
• PF00483: NTP_transferase
  • amino acids 6 to 185 (180 residues), 44.2 bits, E=4.7e-15
• PF12804: NTP_transf_3
  • amino acids 6 to 129 (124 residues), 80.4 bits, E=4.4e-26
• PF00132: Hexapep
  • amino acids 265 to 296 (32 residues), 27.4 bits, see alignment (E = 5e-10)
  • amino acids 392 to 425 (34 residues), 27.7 bits, 3.9e-10
• PF14602: Hexapep_2
  • amino acids 281 to 310 (30 residues), 11.9 bits, see alignment (E = 4e-05)
  • amino acids 394 to 425 (32 residues), 26.3 bits, see alignment (E = 1.2e-09)

Best Hits

Swiss-Prot: 94% identical to GLMU_PSEU5: Bifunctional protein GlmU (glmU) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 94% identity to psa:PST_4189)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• peptidoglycan recycling I (9/14 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

See L0GTW7 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psest_4352 UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (Pseudomonas stutzeri RCH2)
MSLDIVILAAGQGTRMRSALPKVLHPVAGKSMLGHVIDTARALQPQSIQVVIGHGAEQVR
LRLAGDDLDYVVQAEQLGTGHAVAQALPNLSAERVLILYGDVPLIEAETLQRLLQKVGPE
QLALLTVTLDDPTGYGRIVRDARGEVQAIVEHKDASDEQKAIREGNTGILAVPGSRIGEW
LGRLSNSNAQGEYYLTDVIAMAVADGLRVATEQPLDAMEVQGANDRIQLAELERHYQQRA
ARRLMAQGVTLRDPARFDVRGELSVGRDVLIDVNVVLEGTVVIEDDVQIGPNCVIKDSTL
RRGAIIKANSHLEGAVVGEGADCGPFARLRPGAVLGKKAHVGNFVELKNATLGDGAKAGH
LSYLGDAEIGARTNIGAGTITCNYDGANKFKTVMGEDVFIGSNSSLVAPLHLGDGATTGA
GSTITEDVPAHTLGLGRGRQRNIDGWQRPTKK