Protein Info for Psest_4349 in Pseudomonas stutzeri RCH2

Annotation: glucosamine--fructose-6-phosphate aminotransferase (isomerizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 616 (615 residues), 860.5 bits, see alignment E=3.4e-263 PF13230: GATase_4" amino acids 60 to 149 (90 residues), 25 bits, see alignment E=1.7e-09 PF13522: GATase_6" amino acids 66 to 183 (118 residues), 69.2 bits, see alignment E=7.5e-23 PF13537: GATase_7" amino acids 83 to 193 (111 residues), 54.9 bits, see alignment E=1.8e-18 PF01380: SIS" amino acids 291 to 424 (134 residues), 107.5 bits, see alignment E=9.2e-35 amino acids 469 to 598 (130 residues), 86.1 bits, see alignment E=3.8e-28

Best Hits

Swiss-Prot: 88% identical to GLMS_PSESM: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 95% identity to psa:PST_4186)

MetaCyc: 63% identical to L-glutamine--D-fructose-6-phosphate aminotransferase (Escherichia coli K-12 substr. MG1655)
Glutamine--fructose-6-phosphate transaminase (isomerizing). [EC: 2.6.1.16]

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPY1 at UniProt or InterPro

Protein Sequence (616 amino acids)

>Psest_4349 glucosamine--fructose-6-phosphate aminotransferase (isomerizing) (Pseudomonas stutzeri RCH2)
MCGIVGAVAERNITAILLEGLKRLEYRGYDSAGVAVLDDSGTLERLRRNGKVAELEQAQQ
QTPLVGRLGIAHTRWATHGAPCERNAHPHFSGDELAVVHNGIIENHEALRAQLKDMGYVF
VSDTDTEVIVHLLHHKLESLGDLTAALKAAVKELHGAYGLAVISAKQPDRLLAARSGSPL
VIGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRRDSVQIWDVDGEPVQREAVQYHE
GAEAADKGAYRHFMLKEIHEQPKVVQRTLEGRLGDRQVLVEAFGPQAGELFAKVRNVQIV
ACGTSYHAGMVARYWLEELAGIPCQVEVASEFRYRKVVVQPDTLFVTISQSGETADTLAA
LRNAKQRSTEEGGYLASLAICNVGISSLVRESDLTLLTQAGPEIGVASTKAFTTQLVGLM
LLTLSLGHVRGTLSAASEAELVEELRRLPTRLGEALAMDTTVEKISEHFAEKHHTLFLGR
GAQYPVAMEGALKLKEISYIHAEAYPAGELKHGPLALVDADMPVVTVAPNNELLEKLKSN
LQEVRARGGELIVFADREAGFDNAEGIFVVNMPHIHDALAPILYTLPLQLLSYYVAVLRG
TDVDQPRNLAKSVTVE