Protein Info for HP15_p42g33 in Marinobacter adhaerens HP15

Annotation: protein containing resolvase N-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00239: Resolvase" amino acids 11 to 162 (152 residues), 75.6 bits, see alignment E=2.3e-25

Best Hits

Swiss-Prot: 70% identical to PARA4_ECOLX: Resolvase (parA) from Escherichia coli

KEGG orthology group: None (inferred from 72% identity to app:CAP2UW1_4494)

Predicted SEED Role

"Resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRU3 at UniProt or InterPro

Protein Sequence (211 amino acids)

>HP15_p42g33 protein containing resolvase N-terminal domain (Marinobacter adhaerens HP15)
MKKSVTQNARIYLRVSSDSQDLERQEGVIQAAKAAGYYVAGVYRERASGARADRPELLRM
IEDLQPGDVVIAEKIDRISRLPLPEAERLIATIKGKGAMLAVPGIVDLSDLVAGAEGVSK
VVLEAVQELLLKLSLQMARDDYEDRRERQKQGISQAKKRGKYKGRKPDEKRNELIVKLRP
NHTIAETARLAGCSESQVKLVWAKHQKEKDQ