Protein Info for Psest_4345 in Pseudomonas stutzeri RCH2

Annotation: Bacteriophytochrome (light-regulated signal transduction histidine kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 transmembrane" amino acids 626 to 647 (22 residues), see Phobius details PF08446: PAS_2" amino acids 16 to 124 (109 residues), 82.7 bits, see alignment E=9.5e-27 PF01590: GAF" amino acids 151 to 316 (166 residues), 50.7 bits, see alignment E=8e-17 PF00360: PHY" amino acids 335 to 509 (175 residues), 184 bits, see alignment E=5.2e-58 PF00512: HisKA" amino acids 527 to 591 (65 residues), 39.4 bits, see alignment E=1.5e-13 PF02518: HATPase_c" amino acids 635 to 744 (110 residues), 82 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_4182)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU31 at UniProt or InterPro

Protein Sequence (756 amino acids)

>Psest_4345 Bacteriophytochrome (light-regulated signal transduction histidine kinase) (Pseudomonas stutzeri RCH2)
MATTEARDLLAAIDRCADEPIHIPGSIQPHGFLLVVSEPELHVQQASENVQQWLGVEAQS
LLGQPLSNLLPTARLEAGLAALTEDDHNPFHLSDVCIRVHGTVDQTFALLGHRHGGHLIL
EFERADNAHQAYDALYPLMRTFVVQLQETRELEALCQLAVREVKRITGFGRVKAYRFDAE
DNGLVLAEVADPGYPSYLGLCFPAADIPPQARRLYRENLIRVIQDANYTPSPLVPALNPV
SGAPLDLSFAALRSVSPVHLQYMRNMGTLASMSISIVIRDRLWGLISCHDAEPRAVSYQT
RTACELLGRILSLQIEARETETLAQRKLELRHQIVHLLSAMADRDSVVEGFRHLPDVVLG
FAAADGAAIISADKCETVGNTPDHLQILRLTEWLGERRDQLIFHSDCISGDIPEMPELAG
HCAGVMAISISRLHAHYLIWFRQEQIKTVNWAGAPEKQVDRQSGALSPRHSFARWQETLR
GYAQPWDPVVIEGALELRNAVLGIVLRKAEEMAQLAGELRASNKELEAFSYSVSHDLRAP
LRHIAGYTELLSEMESSQLSERGMRFLDNIADAARFAGTLVDNLLSFSQMGRAALRLTDV
DLEALVASIREELAPDCEGRQIEWHLLPMPIVVADAAFLHMVLRNLIDNAVKYSRTREVA
VIEVGAEQRAGEVVVYVRDNGVGFDMQYAGKLFGVFQRLHRMEEFEGTGIGLASVHRIIE
RHDGRVWAEGQLDKGATFYFSLPKLTYTSSLLDRDI