Protein Info for Psest_4336 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 8 to 375 (368 residues), 190 bits, see alignment E=4.3e-60

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_4173)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTV1 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Psest_4336 Uncharacterized iron-regulated membrane protein (Pseudomonas stutzeri RCH2)
MRSILVLVHRYIGLATAVFLFLAGITGSILAFHHELDEWLNPEFYHTTSEGPVLAPGTLV
ERVEQANPRMQVWYMEFPSEPGHAALMALVPRNDPATGKPYDERPVVHYLDAVSGEPVGT
RYWGECCFSRKNFVPFILEFHYNLSLPGNWGLWLMGIVAIAWVIDCLVSLVLTFPRGRPF
LSKWWTAWKIKRQRMNHDVHRAGGLWLWLLLTPVAVSSVAMNLPEQVFKPVVSLFSPVEA
SVYEARGRMPNEQLGTTAYDFHQAYDYAMQHAADLGLTEAITELYYSFEYNFYGAGFGEH
DSNQGNAWLFFHGTDGRLLGQEIPGQGTLGQQFHLLQPAIHGGRILGLPGRILIAVLGVA
IAVLSVTGVVIWWRKRSARRSAAARRDAVMEAEAS