Protein Info for HP15_p42g23 in Marinobacter adhaerens HP15

Annotation: TRAG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 signal peptide" amino acids 23 to 23 (1 residues), see Phobius details transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details PF02534: T4SS-DNA_transf" amino acids 121 to 615 (495 residues), 512.7 bits, see alignment E=1.5e-157 PF10412: TrwB_AAD_bind" amino acids 203 to 568 (366 residues), 65.1 bits, see alignment E=8.8e-22 PF12696: TraG-D_C" amino acids 444 to 568 (125 residues), 86.4 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 85% identical to TRAG5_ECOLX: Conjugal transfer protein TraG (traG) from Escherichia coli

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 85% identity to axy:AXYL_06601)

Predicted SEED Role

"IncP-type DNA transfer coupling protein TraG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRT3 at UniProt or InterPro

Protein Sequence (635 amino acids)

>HP15_p42g23 TRAG family protein (Marinobacter adhaerens HP15)
MKPKINNAVGPQVRDRKPKKQRLLPALGAVSVLGGLQAATQFFAYTFNYQDNLGGHINHV
YAPWSILSWASDWYSIYPDEFMRSGSIGMVVTTVGLLGVAIAKVVTSNSSKASEYLHGSA
RWAEKKDIQAAGLLPRERTALEVVTGKDAPTSTGVYVGGWEDKDGNFFYLRHNGPEHVLT
YAPTRSGKGVGLVVPTLLSWPQSSVITDLKGELWALTAGWRQKHAKNKVLRFEPASSNGG
VCWNPLDEIRIGTEYEVGDVQNLATLIVDPDGKGMDSHWQKTSYALLVGVILHALYKSKN
EGTPATLPVVDAMLADPERDTGELWMEMATYGHVDGQNHPAVGSAARDMMDRPEEEGGSV
LSTAKSYLALYRDPVVARNVSKSEFRIKDLMNHDDPVSLYIVTQPNDKARLRPLVRVLTN
MIIRLLADEMSFEKGRPVAHYKHRLLAMLDEFPSLGKLEILQESLAFVAGYGIKCYLICQ
DLNQLKSRETGYGPDETITSNCHVQNAYPPNRIETAEHLSRLTGQTTVVKEQITTSGRRT
SAMLGQVSRTIQEVQRPLLTPDECLRMPGPTKNAAGDIEKAGDMVIYVAGYPAVYGKQPL
YFKDPVFQARASVDAPKISDKLRIVAEPEGEGVTI