Protein Info for Psest_4328 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome oxidase assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details PF04442: CtaG_Cox11" amino acids 28 to 169 (142 residues), 172.6 bits, see alignment E=2.9e-55

Best Hits

Swiss-Prot: 37% identical to COXZ_NITHX: Cytochrome c oxidase assembly protein CtaG (ctaG1) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 95% identity to psa:PST_4165)

MetaCyc: 72% identical to cytochrome c oxidase assembly protein (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSL8 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Psest_4328 Cytochrome oxidase assembly factor (Pseudomonas stutzeri RCH2)
MNESLPTRRLVRRLLFVVVGMFGFGFLLVPIYDVMCQAFGINGKTAGAYTGVQSADEARA
VRVQFLATNAAGMRWEFGPQADQISVHPGASQEIRFVAYNPTDKPMTAQAIPSVSPSRAA
AYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPADVHNLTLAYTLFDITSRQPPVAVN
ATSAPAKESLQ