Protein Info for Psest_4325 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 transmembrane" amino acids 43 to 60 (18 residues), see Phobius details amino acids 68 to 84 (17 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU13 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Psest_4325 hypothetical protein (Pseudomonas stutzeri RCH2)
MTQAIAVSHRTLHSDKARRNYPPPLSHQSLYPRTGGNVDWIDLLQWPAMVVTVIAAWLIG
SLQPGRRFVGFCCFLLSNLLWVIWGWHAEAWALITLQVCLALMNLRGVKKNDAPAQPEPD
TPRA