Protein Info for Psest_4315 in Pseudomonas stutzeri RCH2

Annotation: ABC-type metal ion transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 60 to 86 (27 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 40 to 224 (185 residues), 70.1 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 55% identical to METI_SALTI: D-methionine transport system permease protein MetI (metI) from Salmonella typhi

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 98% identity to psa:PST_0037)

MetaCyc: 53% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GU04 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Psest_4315 ABC-type metal ion transport system, permease component (Pseudomonas stutzeri RCH2)
MEALFSSLLGNVDWYEIWLATLDTLLMLGGSLLFTILLGLPLGVLLFLCGPRQLFENAPL
YAALSFVVNVLRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPLVVGAAPFFARLVETAL
REVDRGIIEATQAMGATTRQIIFSALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGL
GDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDRLVTHFSRK