Protein Info for HP15_4169 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase (GGDEF domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00229: PAS domain S-box protein" amino acids 25 to 139 (115 residues), 25 bits, see alignment E=1.7e-09 PF13426: PAS_9" amino acids 33 to 138 (106 residues), 33.9 bits, see alignment E=3.2e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 156 to 314 (159 residues), 142.6 bits, see alignment E=9.9e-46 PF00990: GGDEF" amino acids 157 to 311 (155 residues), 137.8 bits, see alignment E=2.8e-44

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMM5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>HP15_4169 diguanylate cyclase (GGDEF domain) (Marinobacter adhaerens HP15)
MFRADFSTCEYLFLNTYNLPTLSDYKWFLNTLPEAALVVDDRGEILIANEMAKRVFKSNG
DSFHAKHVWELIPVEKREGHDDKMASFHKSPEKESRIANSALEAVRGDGTRFAIVIILRQ
ITLACGSYTLAICQDVSEQRYLVTGLRNELDQERLLARTDPLTSIANIRSFRAELERSIE
RLSRYGRHFTLISIDLDNFKPINDEYGHAEGDKVLIDVGDTLKSGLRSGDFPARIGGDEF
AVLLPDTDFDAARKFIPRLVETLENKMKKNDWPVTFSLGVVTFNETPGRVDKALMVADET
MYLAKRSGKNRAAMRTFQ