Protein Info for Psest_4301 in Pseudomonas stutzeri RCH2

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF00072: Response_reg" amino acids 9 to 122 (114 residues), 110 bits, see alignment E=3.5e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to psa:PST_0050)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTR3 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Psest_4301 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Pseudomonas stutzeri RCH2)
MSESASKRILMVEDEEDIAFLIRYMLERHGFVVDHAADGRQALDHFAQAAPPDLTLMDIM
LPYHDGLELIERLRAQAGWESVPVLMLTAKAREVDIVRALELGADDYVTKPFQPEELLAR
IRRLLRGRR