Protein Info for Psest_4300 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 956 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 187 to 206 (20 residues), see Phobius details PF05227: CHASE3" amino acids 39 to 174 (136 residues), 111.5 bits, see alignment E=7.6e-36 TIGR00229: PAS domain S-box protein" amino acids 328 to 450 (123 residues), 25.6 bits, see alignment E=5.4e-10 PF08448: PAS_4" amino acids 338 to 447 (110 residues), 28.8 bits, see alignment E=3.2e-10 PF00512: HisKA" amino acids 451 to 519 (69 residues), 68.3 bits, see alignment 1.2e-22 PF02518: HATPase_c" amino acids 568 to 678 (111 residues), 105.2 bits, see alignment E=6.6e-34 PF00072: Response_reg" amino acids 703 to 818 (116 residues), 32.4 bits, see alignment E=2.3e-11 amino acids 831 to 911 (81 residues), 48.3 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_0051)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTZ1 at UniProt or InterPro

Protein Sequence (956 amino acids)

>Psest_4300 PAS domain S-box (Pseudomonas stutzeri RCH2)
MPARLAIGWHSIAFLAAFVLLAALGWQGARTQEALLQTNRSVSHSLEVITSVQAILTSLQ
DIETGSRGFILTGDASYLEPYERGLKQLEGYRRSLEQLVEGRSYPDVRWFRTLDATIAER
LQVAAGNVQARRDAGLQAAADHLRDAGGNLLMDRLRALLNAVEQQERRQLAAASSAVTQT
TERAQRLVLIGSLVVVALFLIAFWAVHRNLRIRQQLAGAAQAGEARLGALLQAIPDYLYA
VDHQQQVSSLAAGTARRAPPPAAIEPLLHDLLQQREDSGLRQTTWCELQTRRTFEVRLMP
TGLGDHLAIARDISELQRSRDSLHDQQLFLRRVVDTDDNLIFVRDAQGRFLLCNTALSAL
LDVRPQDIEQRHPDEVPSARLLRPLLLDDDELAALASGSGELRTTEVALTDALGTEHWFQ
VIKRPLRTSARTCHVVTVAVDVSLRRRMEQMKTEFISTVSHELRTPLTAIRGALGMLIGG
IAGQVSDEARPLLGIAHKNSERLVRLINDILDIEKLEAGRLTFNFGRHDVRPLVQQALSD
ITPYGQDYGVSLEFLDAPELTSSEATLDPDRFAQVMANLLSNAIKHSPAGGCVTVDLRRR
GKLLEIGVQDRGPGIPEAFRSRIFERFAQADSSDARQRGGTGLGLAITRSLVQQMHGKIG
FDCQPDQGTRFWLQLPLEEHPQQVQAPAQPLIHGSAPQQTPLILILEPDSHAAEQLAEAL
HQHGYATLIAHAAAEARELLGQHRVQALTLSPALDDENSVAFLQSLRSQQHYRSLPVLIV
SLQPQRRDEDDGLLRGGAVGVIDWLHKPIDPSRVMEVIRACLQIGGLKPRILHVEDDDDL
RVLLAKQIASLDVELAGAATLHEARQLISAQPFDLAIIDLMLPDGDGSELFDQLAQSIPP
PPVIIFSALDTPIQDNRLALRQLVKSRHDGDELAKLIQQLLQHWPPGHTHSDEVHA