Protein Info for Psest_4294 in Pseudomonas stutzeri RCH2

Annotation: Fatty-acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 162 to 166 (5 residues), see Phobius details amino acids 228 to 243 (16 residues), see Phobius details PF00487: FA_desaturase" amino acids 11 to 219 (209 residues), 54.2 bits, see alignment E=1.9e-18 PF01610: DDE_Tnp_ISL3" amino acids 287 to 387 (101 residues), 43.7 bits, see alignment E=3e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_0057)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPS7 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Psest_4294 Fatty-acid desaturase (Pseudomonas stutzeri RCH2)
MWHTGLLDLSVWQLIATTLLLTHVTIVSVTVYLHRYSAHRSLELHPALKHFFRFWLWLTT
AMNTREWTAIHRKHHAKCETPDDPHSPVHKGLSTVVRKGAELYMEEAKNEETLRIYGKNC
PDDWIERNLYSRFPNAGIVFMLLIDLALFGVLGLTVWAVQMIWIPFWAAGVVNGLGHAVG
YRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVRKWEFDMGWAWIRLFSLLGL
AKVNRTAPIAHRIEGKQQLDMDSAMAILNNRFQIMAQYRKLVIVPLVRQELGRADASVRH
QLRRAKRLLAREPSLLQQEQQAHIDDMLAQSQALKVIYEKRLALQQIWTRTSSNGHDMLA
AIKQWVHEAEASGIQSLREFAEHLRTYSLRPSVAPA