Protein Info for Psest_4293 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 38 to 166 (129 residues), 45.5 bits, see alignment E=8e-16 PF08447: PAS_3" amino acids 65 to 141 (77 residues), 60.4 bits, see alignment E=1.7e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 166 to 331 (166 residues), 153.9 bits, see alignment E=3.2e-49 PF00990: GGDEF" amino acids 170 to 328 (159 residues), 145.8 bits, see alignment E=1e-46

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_0058)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSJ2 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psest_4293 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MRLASNQSDSGMRMPPGGDAQTLLALIHARAEAARLGEREQLFSTLLGGVNAVLWAFDWQ
AQRMIYVSPAYERIFGRSPALLLADYGEWRNAIYPDDVEFAQKSMLAVLDEGAVETREYR
IIRGDGQLRWLSDKCFIGRGADRGQGPIIVGIAEDITEKKQLEGELQRLATTDVLTQSSN
RRHFFECARIEFERARQFASSLAFLLLDIDDFKRINDTHGHQMGDQVLQKVARCGASVLR
QSDLFGRIGGEEFAAVLPGCQPDLAEQIAERLQREIERVVFTAENGERFRVTASLGLTYL
RANDAELSTVFARADAAMYTAKRLGKNQVIVG