Protein Info for Psest_4287 in Pseudomonas stutzeri RCH2

Annotation: Predicted glutamine amidotransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 5 to 221 (217 residues), 242.5 bits, E=4.5e-76
• PF00117: GATase
  • amino acids 91 to 233 (143 residues), 50.8 bits, E=1.7e-17

Best Hits

Swiss-Prot: 48% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 95% identity to psa:PST_0064)

MetaCyc: 47% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"probable glutamine amidotransferase"

MetaCyc Pathways

• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See L0GRW4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psest_4287 Predicted glutamine amidotransferases (Pseudomonas stutzeri RCH2)
MSRKPLIGVSACTRQIGHHSFHIAGDKYLRAAAIAGVPLVIPALDELIDPATLLESFDGL
LFTGSPSNVEPHHYGGPASDAGTHHDPLRDRLTLPLIRAAVEAGIPVFGICRGFQEMNVA
FGGSLHQKVHEAGPYQDHRERPDDPLDVQYGLSHALHVQPGGLLERLGLPAQIQVNSVHG
QGVERLGGGLRIEALAPDGLIEAFSVEQARSFALGVQWHPEWQVHEHPHYLALFRGFAEA
CEARARQR