Protein Info for Psest_4284 in Pseudomonas stutzeri RCH2

Annotation: Spermidine/putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 39 to 300 (262 residues), 80.2 bits, see alignment E=5.8e-26 PF13416: SBP_bac_8" amino acids 43 to 317 (275 residues), 101.1 bits, see alignment E=2e-32 PF13343: SBP_bac_6" amino acids 76 to 318 (243 residues), 67.5 bits, see alignment E=2.6e-22

Best Hits

Swiss-Prot: 80% identical to SPUD_PSEAB: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 98% identity to psa:PST_0067)

MetaCyc: 61% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPR7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Psest_4284 Spermidine/putrescine-binding periplasmic protein (Pseudomonas stutzeri RCH2)
MNPFAKTLLAMTLAGTVAGAAQAQEKVLHVYNWSDYIAEDTLENFTKETGIKVVYDVFDS
NEVLEAKLLAGSSGYDVVVPSNPFLAKQIKAGVFQKLDKSKLPNWENLDKDLLKALEPSD
PGNQYSIPYMWGTIGIGYNVDKVKAVLGDNAPVDSWDLVFKPENIEKLKSCGVAFLDSPT
EMLPAALHYLGYAPDSGKADELKKAEDLFMQIRPHVAYFHSSKYISDLANGNICVAIGYS
GDIYQGKSRAEEAANGVNVGYKIPKEGAGSFFDMLAVPADAKNVESAHAFINYLMKPDVM
ASITNYVQFPNGNAAATPLLDEAIRTDEGIYPSQAVLQKLYTFPDLDPKTQRAMTRSWTK
IKSGR