Protein Info for Psest_4279 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein involved in response to NO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details PF05940: NnrS" amino acids 13 to 396 (384 residues), 263.5 bits, see alignment E=2e-82

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 56% identity to tmz:Tmz1t_1808)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPR2 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Psest_4279 Uncharacterized protein involved in response to NO (Pseudomonas stutzeri RCH2)
MLKSLSPRLTAWPLLLCSFRPLFLSTVLLAVAGIALWLGFLGFGLPLPSVPGGPMVWHAH
EMLLGFGLAAVAGFVLTAVPEFTSTAAFGRQVGFGFLLLWLAARLSFWLSGVLGPWPSAL
FNSAFAIALLVLLAPRLLGDPLRRQYGFFGGLVALALVTVGFNIDAVSGQYPMRWLHATV
GVMMVLIVVAMSRISMRILNDAIQARRDAGHEVDEDYRARPPRRNLAIFCISLFSLAEWL
ALPAPLNGWLALAATAAMFNLLNDWHIGRALLERWALMLYSVYWLMALGYGALGVSLLVD
GYASSAGRHLLTVGAMGVSILAVLCIAGRTHSGYALDQRPWVPIATGLLVLAALLRASAG
LPGAPVPLLNMLAGLGWLTAFALALRYLAPIWLRPRPDGGAGCDEPQDEHSMGSGCRT