Protein Info for HP15_4142 in Marinobacter adhaerens HP15

Annotation: naphthoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 10 to 256 (247 residues), 244.9 bits, E=8.4e-77
• PF16113: ECH_2
  • amino acids 15 to 197 (183 residues), 73.1 bits, E=3.1e-24

Best Hits

Swiss-Prot: 59% identical to MENB_BACSU: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Bacillus subtilis (strain 168)

KEGG orthology group: K07536, 2-ketocyclohexanecarboxyl-CoA hydrolase [EC: 3.1.2.-] (inferred from 75% identity to bcm:Bcenmc03_6839)

MetaCyc: 67% identical to BadI (Rhodopseudomonas palustris)
3.7.1.-

Predicted SEED Role

"2-ketocyclohexanecarboxyl-CoA hydrolase"

MetaCyc Pathways

• benzoyl-CoA degradation III (anaerobic) (4/9 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See E4PMJ8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>HP15_4142 naphthoate synthase (Marinobacter adhaerens HP15)
MTYEDILYDENNGVATITINRPDRYNAFRGQTCMELLDAFNRAGWNKDIGVIVFTGAGEK
AFCTGGDQGAHEGQYDGRGLIGLPVEELQRTIREVPKPVIARVNGFAIGGGHVLHVICDL
SIASETAIFGQVGPKVGSVDPGFGTAYLARVVGEKRAREIWYLCRKYSAQQALEWGLVNA
VVPPEQLDEEVQKWCEEILEKSPTAISIAKRSFNADSDNIAGIGALGMQALSLYYDTDES
KEGVNAFLEKRKPEFRKYYK