Protein Info for HP15_4136 in Marinobacter adhaerens HP15

Annotation: periplasmic molybdate-binding protein/domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF12728: HTH_17" amino acids 16 to 63 (48 residues), 47.2 bits, see alignment 3.2e-16 TIGR01764: DNA binding domain, excisionase family" amino acids 16 to 62 (47 residues), 41.5 bits, see alignment 6.7e-15 PF12727: PBP_like" amino acids 93 to 277 (185 residues), 189.5 bits, see alignment E=5.6e-60 PF13531: SBP_bac_11" amino acids 153 to 255 (103 residues), 27 bits, see alignment E=5.8e-10

Best Hits

KEGG orthology group: None (inferred from 62% identity to aeh:Mlg_2745)

Predicted SEED Role

"FIG01073729: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMJ2 at UniProt or InterPro

Protein Sequence (304 amino acids)

>HP15_4136 periplasmic molybdate-binding protein/domain protein (Marinobacter adhaerens HP15)
MLLPDPPEKPMSLPAYLTTAEAAEYLRLKERKVYDLVSQGVIPCVRITGKLLFPRQRIDL
WLMNHLEGDDAISAPTPPVLVGSQDPLLEWAVKESNAELAMLCQGSGDGVQRLVDGRAML
AGMHIWHAESERYNDPATLGLTGMRDLVLIRWAKRQQGLLLAPGNPHKLTQLEDIARPGL
RLAHRQPDAGVSHLLQSLLARHRIEGSQLTWAEHPSLSEDDLALAIRQGEADVGIGIEAA
ARRQGLAFIPLQQEHFDLAMRRRHYFEPAMQRLLAFARSERFVQRAEALGGYNISELGNV
VYNA