Protein Info for Psest_4267 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF06490: FleQ" amino acids 12 to 125 (114 residues), 24.6 bits, see alignment E=1e-08 PF00072: Response_reg" amino acids 13 to 122 (110 residues), 110.5 bits, see alignment E=2e-35 PF00158: Sigma54_activat" amino acids 152 to 318 (167 residues), 228.6 bits, see alignment E=1.4e-71 PF14532: Sigma54_activ_2" amino acids 153 to 323 (171 residues), 75 bits, see alignment E=3e-24 PF07724: AAA_2" amino acids 174 to 292 (119 residues), 31.4 bits, see alignment E=7.9e-11 PF07728: AAA_5" amino acids 175 to 293 (119 residues), 35.4 bits, see alignment E=4.2e-12 PF18024: HTH_50" amino acids 403 to 451 (49 residues), 33.5 bits, see alignment 1.1e-11 PF02954: HTH_8" amino acids 408 to 447 (40 residues), 28.2 bits, see alignment 5.3e-10

Best Hits

Swiss-Prot: 81% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 93% identity to psa:PST_0079)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRU1 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Psest_4267 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Pseudomonas stutzeri RCH2)
MSSEHSISAQTQVLLIDDDPHLRQALSQTLDLAGLKVASLGDARELAARLPADWPGVVVS
DIRMPGIDGLELLQQLRARDSELPVILITGHGDIQLAVQAMRAGAYDFLEKPFPSEALLD
SVRRALALRQLVLDNRSLRLALADRQQLSARLLGQSKAMLRLREQIGALAGTQADVLILG
ETGAGKEVVARALHDLSNRRNGPFVAINAGALAESVVESELFGHEPGAFTGAQKRRIGKF
EFANGGTLFLDEIESMSLDVQVKLLRLLQERVVERLGGNQSIALDIRVIAATKEDLRVAA
DQGRFRADLYYRLNVAPLGIPPLRERNEDILLLFQHFAEAGAQRHGLPIRELQPEQRAAL
LRHAWPGNVRELQNTAERFALGLGLGLDQPGAEPTSSVAGTGNLSEQVEAFERALIAAEL
NRPHGSLRSVAEALGVPRKTLHDKLRKHGLNFSDAGGSSPDEND