Protein Info for PGA1_c04300 in Phaeobacter inhibens DSM 17395

Annotation: putative ATP-binding protein PhnN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02322: phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN
  • amino acids 1 to 166 (166 residues), 160.8 bits, E=1.3e-51

Best Hits

Swiss-Prot: 62% identical to PHNN_RUEST: Ribose 1,5-bisphosphate phosphokinase PhnN (phnN) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K05774, ribose 1,5-bisphosphokinase [EC: 2.7.4.23] (inferred from 62% identity to sit:TM1040_3697)

MetaCyc: 44% identical to ribose 1,5-bisphosphate phosphokinase (Sinorhizobium meliloti 1021)
Ribose 1,5-bisphosphate phosphokinase. [EC: 2.7.4.23]

Predicted SEED Role

"ATP-binding protein PhnN; Guanylate kinase (EC 2.7.4.8)" (EC 2.7.4.8)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• dZTP biosynthesis (3/5 steps found)
• glyphosate degradation III (4/7 steps found)
• methylphosphonate degradation I (2/5 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.8

Use Curated BLAST to search for 2.7.4.23 or 2.7.4.8

Sequence Analysis Tools

See I7DXI0 at UniProt or InterPro

Protein Sequence (181 amino acids)

>PGA1_c04300 putative ATP-binding protein PhnN (Phaeobacter inhibens DSM 17395)
MIAVVGPSGVGKDSLMDALLERVPGLVRQRRIITRAPELGGEDYDAVTEDRFAMLCSAPG
FALHWQAHGLRYAIPRDIDELRNRASGVLVNLSRKVLLEAEAAFGTLIVLSVTAAPEALA
ARLSARGREDSAEVERRLARASTPVPAGLSQVFDIDNSGQLEEAIKAAETALMPWLQPER
A