Protein Info for HP15_407 in Marinobacter adhaerens HP15

Annotation: transporter, major facilitator family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 155 to 157 (3 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 350 (338 residues), 171.9 bits, see alignment E=1.9e-54 PF00083: Sugar_tr" amino acids 44 to 166 (123 residues), 29.5 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: None (inferred from 82% identity to maq:Maqu_0747)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMP3 at UniProt or InterPro

Protein Sequence (456 amino acids)

>HP15_407 transporter, major facilitator family (Marinobacter adhaerens HP15)
MNALEKRSVFALASVYAMRMLGLFMVLPVFMLLGEDLKDATPALLGLAIGAYGLSQALLQ
IPFGMLSDRVGRKRMIYIGLVLFAAGSLLAGATDSIYVVIAGRILQGAGAIASVLMALLS
DLTREEERTKAMATVGITIGLSFSVSLVLGPLLGAWWGLSGIFYTTAALAVVALVIVNRV
VPTPHQHKTSPDTHPAREMLGRVLSDGRLLRLDFGIFALHLVLTALFLVFPSMLQEQFGL
ASSSHWWFYLSVMVTSFFAMVPFIIIGEKKRRMKPVLCGAIALLTLATAGFTGVSSSLVA
AWAVLFFFFMAFNLLEASLPSLISKEAPAASKGTAMGVYSTSQFMGAFLGGAFGGYLLEV
AGLQGVLWFMVVVLGLWLLIALTMPAPGHTTSFVVQLQQVMNDQYDDIDNNLRRLPGVQD
VVIVEDAATAYLKVDRQQFDEALLADFSFVRQANHS