Protein Info for Psest_4261 in Pseudomonas stutzeri RCH2

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 323 to 336 (14 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 17 to 361 (345 residues), 63.4 bits, see alignment E=3.3e-21 PF12698: ABC2_membrane_3" amino acids 29 to 367 (339 residues), 127.4 bits, see alignment E=1.1e-40 PF01061: ABC2_membrane" amino acids 144 to 340 (197 residues), 85.3 bits, see alignment E=6.6e-28

Best Hits

Swiss-Prot: 62% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 83% identity to psa:PST_0085)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTM0 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Psest_4261 ABC-type multidrug transport system, permease component (Pseudomonas stutzeri RCH2)
MGGLRRKLGNIFQLGLKELRSLYRDPAMLVLIIYSFTLAIYEGATAIPEAPHRASIAVVD
EDRSQASLRIINAFQLPYFIEPKAITLQKMDSGMDDGLYTFTLNIPPRFQQDLLAGRQPT
IQLNVDATQVSQAFTGAGHIQQIIASETAEFVRRYRSSDALPVEAVVRTAFNPNLSRAWF
GAVNEVINQITMLAIILTGAALIREREHGTIEHLLVMPVTPFEIMVGKVWAMGLVVLAAA
AFALRFVVEGWLNIPIQGSLWLFAGGAALHLFAATSMGIFFGTVARSMPQLGLLVILTLI
PLQILSGGVTPRESMPELVQNIMLVAPTTHFVELAQAILFRSAGPSIVWPQLLALAVIGT
VFFLGALSRLRVSLR