Protein Info for Psest_4247 in Pseudomonas stutzeri RCH2

Annotation: Serine/threonine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF13672: PP2C_2" amino acids 20 to 204 (185 residues), 44.4 bits, see alignment E=2.2e-15 PF00481: PP2C" amino acids 30 to 141 (112 residues), 38.6 bits, see alignment E=1.5e-13 PF07228: SpoIIE" amino acids 37 to 242 (206 residues), 28 bits, see alignment E=3e-10

Best Hits

KEGG orthology group: K11915, serine/threonine protein phosphatase Stp1 [EC: 3.1.3.16] (inferred from 76% identity to pmy:Pmen_0105)

Predicted SEED Role

"Protein serine/threonine phosphatase PrpC, regulation of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRS3 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Psest_4247 Serine/threonine protein phosphatase (Pseudomonas stutzeri RCH2)
MDATACSWRSAARTDTGKVRARNEDAFLDLPQAGLWAVADGMGGHQNGALASRLIIEQLA
DLSTTGDLPERLLALRRCLHELNRRLSQELTVTAERPDPVIGSTVVALLMEGDHAACIWA
GDSRCYLWRSGRLYQLSRDHSLLQQLIDEQQLSPEVAAKHPAAHALTRAIGASEKLELDI
LEFVVLPGDTLLLCSDGLYQSMSADALGAALSLPSTQLALERLFRQALKGPARDNLSAVV
IRR