Protein Info for Psest_0418 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 241 to 348 (108 residues), 85.8 bits, see alignment E=1.4e-28 amino acids 369 to 414 (46 residues), 37.9 bits, see alignment 7.3e-14 PF00990: GGDEF" amino acids 242 to 347 (106 residues), 84.1 bits, see alignment E=4.7e-28 amino acids 367 to 410 (44 residues), 31.7 bits, see alignment 6.1e-12

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_3859)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIA6 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Psest_0418 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MSRAVSPRFNHFVAPLALLVGGEVIARQVSLNEFFTSLYNVLPTVLLLLGGALCLMYGRI
RECFLLLCVYLVYFLLDTHADYYRDRGSLLDDAALTFHLCSLLLPLLYGLFGVWRERSHL
AQEGLARAAVLFAVGIVALALARRFPDALHAWLVVIRWPALQADWLQLIQLAYPAFLAAL
VLLTMQYLRQPRPSHAAQIVGLVGVLLMLPQTFSRGAALNVLSSHVLLMLVAAIAHEAYL
MAFRDELTGLPGRRALNERLQRLGRQYVLAMADVDHFKRFNDTYGHDVGDQVLKMVASRL
RKIGGGGRAYRYGGEEFTLVFSGRSVEECLPHLEAIRQSVESYALQLRDASSRPKDDRLG
RTARGKVSTSQVSVTISIGVAERQGEQRTPDEVIKAADQALYGAKKAGRNCVRVHGSGRG
AVRMNGHSR