Protein Info for PGA1_c04280 in Phaeobacter inhibens DSM 17395

Annotation: phosphonates transport ATP-binding protein PhnK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR02323: phosphonate C-P lyase system protein PhnK" amino acids 3 to 254 (252 residues), 389.4 bits, see alignment E=2.9e-121 PF00005: ABC_tran" amino acids 21 to 177 (157 residues), 105.1 bits, see alignment E=4.6e-34

Best Hits

KEGG orthology group: K05781, putative phosphonate transport system ATP-binding protein (inferred from 91% identity to sit:TM1040_3699)

Predicted SEED Role

"Phosphonates transport ATP-binding protein PhnK" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETW4 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PGA1_c04280 phosphonates transport ATP-binding protein PhnK (Phaeobacter inhibens DSM 17395)
MTPLLQVKNLAKMYGARIGCTDVSFDLYPGEVMGIVGESGSGKSTLLNSMAGHLTPDRGE
VIFDTRTDGPVDTVTMSEPARRMLGRTDWAFVHQHAREGLRMSVSAGGNIGERLMAVGDR
HYGNIRSHAADWLGRVEIAESRIDDRPTAFSGGMQQRLQIARNLVTGPRLVFMDEPTGGL
DVSVQARLLDLLRSLVREMGLSAIIVTHDLAVVRLLADRLMVMKDGHVVETGLTDQVLDD
PQHAYTQLLVSSVLQV